PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P05110_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 308aa    MW: 33488.8 Da    PI: 5.0248
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P05110_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.31.7e-102432752355
                             SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             +yp++ee+++LA+k+gL+++q+ +WF N+R ++
  GSMUA_Achr11P05110_001 243 PYPTEEEKAKLAEKTGLDQKQINNWFINQRKRH 275
                             8*****************************885 PP

2ELK35.22.7e-12195216122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELK++Ll+KYsgyL++L++EF+
  GSMUA_Achr11P05110_001 195 ELKEMLLKKYSGYLSNLRKEFL 216
                             9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-214892IPR005540KNOX1
PfamPF037901.0E-215090IPR005540KNOX1
SMARTSM012566.1E-2695146IPR005541KNOX2
PfamPF037913.5E-2498145IPR005541KNOX2
PROSITE profilePS5121311.261195215IPR005539ELK domain
PfamPF037891.0E-9195216IPR005539ELK domain
SMARTSM011881.9E-6195216IPR005539ELK domain
PROSITE profilePS5007113.086215278IPR001356Homeobox domain
SMARTSM003897.0E-14217282IPR001356Homeobox domain
SuperFamilySSF466895.13E-20217287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-28220279IPR009057Homeodomain-like
CDDcd000869.60E-14227279No hitNo description
PfamPF059209.9E-18235274IPR008422Homeobox KN domain
PROSITE patternPS000270253276IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEDLFSIHPG ILGGGETPAV GLASSCQGTS EASEVTGSSG GGGSDLTDLI KAQIANHPRY  60
PSLLSAYIEC QKVGAPPEVA TLLEEIGRER YSSMGGGEIG ADPELDEFME SYCHVLVRYK  120
EELLKPFDEA ASFLNDIEMQ LTKLCKGSSS AAAAAAAAAA AVAAAATGNS PSELCCGDLE  180
TSEGQECGSR LADQELKEML LKKYSGYLSN LRKEFLKKRK KGKLPKDARL MLLDWWNTHY  240
RWPYPTEEEK AKLAEKTGLD QKQINNWFIN QRKRHWKPSD DMRYALMEGV SGGSSGTMLY  300
FDRGAIGP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210219LRKEFLKKRK
2216220KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382496.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_009382495.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-125KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLM0RPJ10.0M0RPJ1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P05110_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-76KNOTTED1-like homeobox gene 6